Loading...
Statistics
Advertisement

OUTROXTREME
www.outro.co.kr/

Outro.co.kr

Advertisement
Conversion Technology Metas Server
Outro.co.kr is hosted in Korea, Republic of . Outro.co.kr doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Outro.co.kr

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • nginx

Powered by

  • PHP/5.3.13p1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Outro.co.kr

Missing HTTPS protocol.

    Meta - Outro.co.kr

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 183.111.174.8
    • Latitude: 37.51
    • Longitude: 126.97
    • Country: Korea, Republic of

    Rname

    • ns2.cafe24.com
    • ns2.cafe24.co.kr
    • ns1.cafe24.co.kr
    • ns1.cafe24.com
    • uws64-127.cafe24.com

    Target

    • postmaster.outro.co.kr

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Mon, 23 May 2016 03:17:48 GMT Content-Type: text/html Vary: Accept-Encoding P3P: CP='NOI CURa ADMa DEVa TAIa OUR DELa BUS IND PHY ONL UNI COM NAV INT DEM PRE' X-Powered-By: PHP/5.3.13p1 X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

    DNS

    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: A
    4. ip: 183.111.174.8
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: ns2.cafe24.com
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: ns2.cafe24.co.kr
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: ns1.cafe24.co.kr
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: ns1.cafe24.com
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: SOA
    4. mname: outro.co.kr
    5. rname: postmaster.outro.co.kr
    6. serial: 20140915
    7. refresh: 10800
    8. retry: 3600
    9. expire: 3600000
    10. minimum-ttl: 43200
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: uws64-127.cafe24.com
    host: outro.co.kr
    1. class: IN
    2. ttl: 1800
    3. type: TXT
    4. txt: v=spf1 ip4:183.111.174.8 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.utro.co.kr, www.obutro.co.kr, www.butro.co.kr, www.ohutro.co.kr, www.hutro.co.kr, www.ogutro.co.kr, www.gutro.co.kr, www.ojutro.co.kr, www.jutro.co.kr, www.omutro.co.kr, www.mutro.co.kr, www.o utro.co.kr, www. utro.co.kr, www.ovutro.co.kr, www.vutro.co.kr, www.otro.co.kr, www.ouwtro.co.kr, www.owtro.co.kr, www.ouetro.co.kr, www.oetro.co.kr, www.oustro.co.kr, www.ostro.co.kr, www.ouatro.co.kr, www.oatro.co.kr, www.ouro.co.kr, www.outqro.co.kr, www.ouqro.co.kr, www.outaro.co.kr, www.ouaro.co.kr, www.out ro.co.kr, www.ou ro.co.kr, www.outwro.co.kr, www.ouwro.co.kr, www.outero.co.kr, www.ouero.co.kr, www.outzro.co.kr, www.ouzro.co.kr, www.outxro.co.kr, www.ouxro.co.kr, www.outcro.co.kr, www.oucro.co.kr, www.outo.co.kr, www.outrio.co.kr, www.outio.co.kr, www.outroo.co.kr, www.outoo.co.kr, www.outrlo.co.kr, www.outlo.co.kr, www.outrlo.co.kr, www.outlo.co.kr, www.outr.o.co.kr, www.out.o.co.kr, www.outr.co.kr, www.outrob.co.kr, www.outrb.co.kr, www.outroh.co.kr, www.outrh.co.kr, www.outrog.co.kr, www.outrg.co.kr, www.outroj.co.kr, www.outrj.co.kr, www.outrom.co.kr, www.outrm.co.kr, www.outro .co.kr, www.outr .co.kr, www.outrov.co.kr, www.outrv.co.kr,

    Other websites we recently analyzed

    1. Leonardo Almeida | Sposen Realty & Development
      San Antonio (United States) - 67.192.7.83
      Server software: Apache
      Technology: Maxcdn, OSS CDN, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery Validate, jQuery UI, Php, Pingback, Wordpress
      Number of Javascript: 38
      Number of meta tags: 3
    2. 63355.xyz
      San Jose (United States) - 23.27.192.115
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. virgingalacticspaceflightsystems.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    4. cheaplouboutinsssstores.com
      Switzerland - 141.8.225.181
      Server software: nginx/1.9.2
      Technology: Html
    5. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
      Academia de Tênis de Mesa Especializada
      Houston (United States) - 192.185.217.48
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Javascript
      Number of Javascript: 12
      Number of meta tags: 5
    6. petalumahomesonline.com
      Scottsdale (United States) - 184.168.221.61
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    7. Intro
      Berlin (Germany) - 81.169.145.151
      Server software: Apache/2.2.31 (Unix)
      Technology: Html
      Number of meta tags: 1
    8. www.superbugs.tv
      Ashburn (United States) - 52.0.217.44
      Server software:
      Technology: CSS, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 2
    9. magazines-america.com
      Scottsdale (United States) - 50.63.202.93
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. Kulturno i sportsko društvo SANDŽAK u Sloveniji
      Slovenia - 91.185.211.46
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cookie, Php, Swf Object
      Number of Javascript: 10
      Number of meta tags: 4

    Check Other Websites